DEV Community: Saif Al Shahriar

Why Every Creator Should Read Steal Like an Artist

Saif Al Shahriar — Mon, 16 Feb 2026 16:45:42 +0000

Recently, I finished reading Steal Like an Artist by Austin Kleon—and honestly, it delivered real value. I believe some of its lessons are worth sharing with you.
One of the most powerful ideas in the book is this: creativity is not about pure originality—it’s about transformation. We often believe great ideas appear out of nowhere ✨. But Kleon challenges that myth. He explains that every creative work builds on something that came before it. Nothing is 100% original—and that’s actually freeing. Instead of waiting to be “fully original,” just start creating.
Kleon encourages us to “steal like an artist.” Of course, this doesn’t mean copying someone blindly. It means studying the people you admire, understanding what makes their work powerful, and then transforming those influences into something personal and new. Don’t copy one person—learn from many. When you mix different inspirations with your own experiences, your work naturally becomes unique 🎨.
Another important lesson? Don’t wait until everything feels clear. Many people delay starting because they don’t know their style or identity yet. But Kleon explains that identity develops through action. You discover your voice by creating consistently. Clarity comes from doing—not from overthinking 💡.
The book also emphasizes the importance of sharing your work. In today’s connected world, creators can share not only the final product but also the process. Showing your progress, ideas, and even failures helps you build genuine connections. According to Kleon, talent alone isn’t enough—you also need visibility and generosity 🌍.
Finally, the book highlights discipline and routine. Creativity isn’t just about sudden inspiration; it requires consistent effort. Simple habits—working regularly, staying curious, and maintaining balance—help sustain creativity in the long run ⚡.
Overall, Steal Like an Artist teaches that creativity is accessible to everyone. By embracing influence, taking action, sharing your journey, and staying consistent, anyone can create meaningful work.
And if you have the time, I highly recommend reading this book. I can confidently say—it will not waste your time. 🚀
If you'd like the PDF of this book, just shoot me a message

steal-like-an-artist #get-creative

Voixr Review 2025: Make human voiceovers in 144+ languages in seconds

Saif Al Shahriar — Wed, 16 Apr 2025 13:20:34 +0000

What is Voixr?

Voice is an all-in-one AI platform designed for the next generation that allows you to produce ultra-realistic voiceovers and high-quality written content in minutes, no voice actor or writer necessary. It provides lifelike speech, more human-like and emotional speech with over 1600 voices in 144+ languages and dialects. Voixr’s voice cloning is quite advanced in that it enables you to clone a voice from a short audio clip for humanistic audio. And on the writing side, it is an AI content generator you already have that caters to script, blog, etc., but it is a more powerful one for content creators, educators, marketers, and businesses, as it can help save time and improve their quality.

Voice Review: Features

Voixr is a revolutionary design-related AI platform that converts text into realistic audio. A suite of features designed for different content needs:
Text to Speech: 1600+ real-sounding voices (144+ languages and dialects) with support for English accents (American, Indian, British, etc.).
Voice cloning technology: Clone your voice (or sound like semi-famous public figures) in 15 seconds by simply submitting an audio sample. It helps ensure branding consistency and brings a personal touch to all your projects.
AI sound studio and editing tools: Custom voiceovers tailored perfectly to you — modify speed, natural breaks, and pitch. This easy or good studio enables you to record voices and filter audio free from offering any technical or tech skills, thus saving 80% of the edit time.
Speech to text & transcription: Speech Recognition- Convert your webinars, live recording, or video/audio into text in 170+ languages, perfect for subtitles, transcriptions, or repurposing content.
AI content suite for TikTok or YouTube: write scripts, check for plagiarism, and rewrite or summarize long pieces of writing. Even Voixr could generate blog posts and marketing copy for you in seconds.
Multi accent support: Choose English accents like American, British, Australian, or indian so your content becomes easier to read for regional people.
Long-form voice-overs: Generate long-form voice-overs in any accent. Ideal for podcasts, online courses, or documentaries.

>>> LEARN MORE <<<

How does it work?

Voixr works in 4 easy steps
Step 1
Access: Hit any of the buttons on this page to access the official Voixr page.
to click any of the yellow buy buttons to purchase Voixr before the charges per month start.
Step 2
Paste or use AI to Generate Voiceover script: Paste your Own text or ask AI to write a Perfect voiceover script for you in a Few Clicks.
(Just enter a few buttons or type — It’s that easy!)
Want a YouTube shorts video on weight gain? Just say the word! You can use Voixr to generate any kind of video you want.
Step 3
1600+ emotion-based human voice clones: Pick between artificial intelligence narrators that present realistic sound across ethnicities, tone, emotion, gender, and unique personas.
Step 4
Generate and listen: Hit “Generate” and see your text come to life with a natural voiceover.
Pros and cons
Pros
A nearly human-sounding sounding highly realistic AI voice
Intuitive UI: Navigation is extremely easy to follow – any team member can learn to use the system.
Read more: Call recording features: Users can record calls for future reference, ensuring accountability and clarity.
Cross-Platform support: It is also available for mobile and desktop.
Audio: Provides good voice quality with low latency.
Multilingual support and Emotions & tone customization.
Cons
It may take some trial and error to tune into your emotions
Not suitable for technical or creative long-form writing
You cannot download data, You need a stable internet connection.

Bonuses

Bonus 1
Your Live invite to: Voixr $10K Monthly Extravaganza!
You are invited to a free live training where you will discover the A-B-C formula to make $10,000 a month, regardless of your prior experience!
Bonus 2
Voixr outreach — The Only AI Tool You Need To Reach Clients In Need Of Voiceover!
Cut the monthly fees and get Voixr Outreach to supercharge your cold mail marketing! Send newsletters, create branded campaigns, and track results — without breaking a sweat. With Voice Outreach's dynamic list features and organization of your contacts, your email campaigns are just one elegant touch away.
Bonus 3
The Future of Voiceover Marketplaces with Voixr
You are powered by data up to October 2023.
This user-friendly platform will allow you to display and sell your AI-driven voiceovers to clients internationally and receive payment.
Bonus 4
Easy Invoicing & Billing – Voice Biller
Voixr Biller is an invoicing and billing platform as a service (SAAS Based). It is a web-based application that enables businesses to prepare invoices & estimates, create recurring bills, and get paid quickly.
Respectively choose whether you prefer a one-off payment or recurring payment so that they will always remain in the loop and will be able to pay you faster than before without any hassle with Voice biller.
Bonus 5
Click to Audio — Voixr Speaker – Convert your webpage into virtual Audio
Voixr speaker is a WordPress plugin aimed at turning webpage content into human-sounding speech. The voice speaker plugin applies the newest artificial intelligence and machine learning technologies to release a high-quality human voice and embed an audio player with the content onto the page.
Speaker Plugin+ is built on top of the Google Cloud Platform, ensuring best-in-class speed, reliability, and performance worldwide.

180-day money-back guarantee

You can give Voixr a whirl with absolute confidence— entirely risk-free for you and your clients.
If faced with any problem or not achieving the desired results, a support ticket must be submitted within 180 days to get a complete refund. No hassle, no worries!
>>> LEARN MORE <<<

Voixr #Voixrreview #voiceclone

ZapAi Review: The Ultimate Whatsapp Autoresponder For 2025

Saif Al Shahriar — Mon, 17 Mar 2025 07:27:14 +0000

What is ZapAI?
ZapAI is a powerful AI-driven Whatsapp autoresponder that helps you send unlimited bulk messages to unlimited contacts with an incredible 98% open rate! Are you unlike email marketing, which often gets ignored, This AI tool takes advantage of WhatsApp's massive 2.78 billion active users to connect with people instantly and personally.
With smart features like AI-generated massages, automated chatbots, and lead extraction, ZapAi makes it easy to boost engagement, increase conversations, and grow your business effortlessly.
ZapAI Review: feature
Next-Gen Technology: ZapAI leverages state-of-the-art NexusAI technology to deliver superior performance and results.
Seamless Connectivity: It is easy to connect with customers across platforms like WhatsApp and ChatBots for maximum reach.
Effortless Lead Generation: With minimal effort Quickly identify and engage potential customers.
Guaranteed Delivery: Ensure your massages reach your destination with a 100% delivery rate through list cleaning.
Unlimited Outreach: send unlimited messages to unlimited subscribers, helping you scale your business effortlessly.
Smart Scheduling: Plan and automate messages for optimal timing and impact.
Simplified Automation: streamline your communication strategy with automated tools that save your time and increase efficiency
Personalized Messaging: create and customize your content with ZapAI to connect with your targeted audience on a deeper level.
Omnichannel Reach: Engage customer on their preferred platforms, ensuring you are always where they are
Data-driven insights: Track performance with advanced analytics to refine and optimize your strategies.
High open rates: Achieve a 98% open rate with WhatsApp, ensuring your messages are sent and read.
Faster Messaging: Send messages at lightning speed with dual sim support for enhanced efficiency.
Cost-effective solution: Access powerful messaging tools without breaking the bank.
Maximize Engagement: Ensure your messages land in inboxes, increasing their impact and effectiveness.
Stay Competitive: Stay Ahead of the competition with innovative features and cutting-edge technology
Instant Results: Experience rapid outcomes with ZapAI's fast messaging capabilities.
Dedicated Support: Get instant live support for any questions or issues.
User-friendly interface: No technical or tech skill required — take full control with an intuitive, easy-to-use platform.
One-time payment: Pay one time and get; lifetime access with no recurring monthly fees.

How does it work?
ZapAI creates and sends unlimited bulk messages to unlimited contacts across WhatsApp in just 3 simple steps…
Step1
Login: click on the buttons on this page to get AI Assistance
Step2
Import and auto-extract contacts: Our built-in lead finder and verifier allow you to import your contact list or Extract Red Hot Mobile instantly leads in any niche.
Step3
Profit: The free commercial license includes the ability to send messages to clients and charge them a premium fee, which, according to market rates, is quite a lot….
ZapAI review: pros and cons
Pros:
High open rates:98% open rates ensure your messages are seen
Unlimited massaging: without any restrictions on the number of messages or contracts.
AI-powered features: ZapAI automates the heavy lifting, from message creation to lead extraction.
User-Friendly: No technical or tech skill is required to get started.
Cost-effective: A one-time payment with no monthly subscriptions.
Cons:
WhatsApp Dependency: While WhatsApp is Widely used, businesses targeting audiences on other platforms may need additional tools.
Limited time offer: the 417b price is only available for a short period.
ZapAI Review: Whom is it suitable for?
Affiliate Marketer
Agency Owners
CPA Marketer
ICOM Store Owners
Product Creators
Bloggers
Local Business Owners
Freelancers
Video Marketers
And many others…. It’s the ultimate marketing tool in your arsenal.
Why you should Get ZapAI?
ZapAI Software- The Ultimate WhatsApp Marketing Tool.
Get full access to the ZapAI software, a smart NexusAI-powered WhatsApp marketing app that lets you create and send unlimited bulk messages to Unlimited Phone contacts in minutes.
ZapAI Mobile edition-Take It Anywhere
You can run your campaigns on the go with the ZapAI mobile edition- Included 100% free when you buy access to ZapAI
Access to Microsoft and Googler’s AI
ZapAI combines the power of nexus AI and WhatsApp, creating an even smarter and better messaging tool–something no one else has done before!
No Monthly Fees- Just One Low Payment
Unlike Email Autoresponder, ZapAI has no monthly fees, just a One-Time payment and you get lifetime access.
You’ll get the best deal compared to any other alternative tools…
>>> VISIT THE OFFICIAL WEBSITE <<<

Bonuses
Bonus 1
ZapAI $10K Monthly extravaganza- your vip invite!
You will be invited to free live training to discover step-by-step formulas for increasing your monthly income from $0 to $10k, regardless of your experience level!
Bonus 2
Wow, Bot — your 24/7 AI Chatbot for More Sales!
WoowBot is an AI-powered WordPress chat assistant. Google's Dialog Flow AI, help customers:
Find and add products to their cart
Get support—all from the chat window
Chat seamlessly
Bonus 3
Charge Restaurant Monthly FEES For This...
Turn restaurants into paying clients with ZapOrder a WhatsApp-based online ordering and reservation system with a QR menu. It's a secure, well-documented, fast, and user-friendly SaaS solution that helps restaurants accept orders, manage reservations, and process payments!
Bonus 4
AIKit – AI-powered Autoblogging for fresh Content
AIKit is a powerful WordPress plugin that connects your blog to OpenAI’s GPT-3, allowing you to:
Generate high-quality content in minutes
Summarize, paraphrase, and simplify the text
Write engaging marketing copy effortlessly
Bonus 5
ZapAI SMS– Start your own massaging Platform
Start your Own SaaS business, with a whitelabel license. Letting users use their Android device as an SMS gateway and users send & receive SMS or WhatsApp messages.
FREE BONUS GIFT– Forr action takers only
They announced that the First 100 Buyers Get the ZapAI unlimited commercial license 100% free…
If you are among the first 100 smart action-takers, you will unlock:
Unlimited commercial rights – offer ZapAI as a service and keep 100% of profits
A Huge Competitive Edge – I think This deal is so exclusive, you won't find it anywhere else
BUT HURRY - Once 100 licenses are claimed, this deal disappears forever.
ZapAI Review- 180 days money back guarantee
When you can buy complete confidence and experience ZapAI risk-free for yourself and your clients.
If you face any issues or don't achieve the desired results, simply submit a support ticket within 180 days, and they will refund every penny.
ZapAI Review: My Recommendation
After thoroughly researching ZapAI, I found it to be an effective product for WhatsApp bulk messaging. The ZapAI interface is simple and user-friendly or their video training and effective support systems make it even more so. With some steps, you can send unlimited messages in unlimited contracts without any technical skills.
ZapAI offers a 180-day money-back guarantee, ensuring that your buying decision is risk-free. For these reasons, my recommendation is clear: you can confidently buy it.
>>> VISIT THE OFFICIAL WEBSITE <<<

ZapAIReview #ZapAI #Bulkmessaging #Whatsappmessaging #WhatsAppbulkmessaging

GPT Apps Engine Review- Build & Sell AI Apps Instantly Without Coding

Saif Al Shahriar — Tue, 04 Mar 2025 09:12:23 +0000

What is the GPT Apps Engine?

GPT Apps Engine is a state-of-the-art platform designed to help anyone build and sell generative AI apps without writing a single line of code. With these AI-driven tools in high demand, this platform effortlessly positions you to capitalize on a booming trend. Using this tool, you can create hundreds of apps using pre-designed templates tailored to market or business needs.

GPT Apps Engine Review-Features
Quickly build “GPT Apps in Minutes” for any purpose
225+ Done for your software App templates
Train AI-powered apps using your data sources
Launch 100% white-labeled Apps with ease
Effortlessly embed apps anywhere with just 1-line of code
No-code Builder with drag-and-drop simplicity
Latest ChatGPT API Models (GPT-3.5, GPT 4 turbo, GPT-4.0)
Collect tons of leads with custom interaction and lead Collection
Deliver personalized AI solutions to clients in one click
Train your AI to communicate your brand’s language, knowledge, and style.
Launch apps within minutes and start earning big profits
Create multilingual software Apps for a global reach
The easiest way to white-label GPT Apps for any Need
Make money with a commercial license- launch and sell unlimited AI apps to clients.
>>> LEARN MORE <<<

GPT App Engine Review- pros and cons

Pros:

Easy to use: No coding or technical skills needed.

One-time payment: Pay once, with no recurring fees.

Ready-made template: Pre-designed templates for various industries save time and effort.

High customizable: Allow for deep personalization of apps.

Scalable: Works for solo entrepreneurs and agencies managing multiple clients.

Lifetime access: No hidden fees or subscriptions.

High Earning Potential: It is easy to monetize your apps and grow your income.

Cons:

Learning Curve: First-time users may need a few hours to explore all features

Internet required: It’s a cloud-based platform, and it requires an active Internet connection.

Limited free credits: You will need to buy extra credits if you exceed the limit

While there are a few small drawbacks, the Gpt Apps Engine stands out as a powerful, beginner-friendly solution for building AI-powered and cost-effective.

What can you do with the GPT Apps Engine?

GPT APPS Engine gives you the power to create, sell, and scale AI-powered apps without any coding… whether you want to Build a profitable SaaS business, offer AI solutions to clients or you can start your own AI agency, this platform makes it easy for you.

You can build custom solutions, such as “course planners” for educators or “product Feeder” Apps for online shops.

Sell unlimited AI apps in high-demand markets like content creation, automation, or lead generation.

Create AI assistants that match your client's needs, such as customer care AI for businesses or learning AI for education.

Generate recurring revenue by providing AI-powered service, without coding, hosting, or development headaches.

With the GPT app engine, you’re not just using AI; you're building a profitable future with it.
>>> LEARN MORE <<<

GPTAppsEngine #GPTAppsEnginereview #Appscreator

InstaBoost Review: Grow Your Instagram Account Fast Organically

Saif Al Shahriar — Wed, 19 Feb 2025 10:54:23 +0000

Hi there, today I will introduce you to a game changer AI tool for Instagram users.

In this review, I will share my honest opinion of InstaBoost. So let’s start the review….

What is InstaBoost?

InstaBoost is an Advanced AI Tool made for Instagram users who want to grow their accounts organically.

One billion people use Instagram daily, but only 1% know how to leverage it for a massive number. InstaBoost cracks the method. It will generate real followers and engagement without any hassle or time spent. InstaBoost will grow your Instagram profile to a targeted audience, no matter what your niche.

InstaBoost features

Automate Following, unfollowing, liking, and commenting: save time by automating interactions with your audience.

Target Follower for Specific Users: Focus on the followers of the influencer and grow your own following faster.

Target options

Followers/posts from a hashtag search
A specific user’s follows
Users who like or comment on specified posts
Users/Posts found through a Google search
Your feed
Users who posted by location
AI-powered Hashtag Generation: It Increases your visibility with smart hashtag suggestions tailored to your content.

AI-powered Comment Generation: It will generate comments for you.

Increase Your Visibility: Boost your Instagram profile’s activity and attract more followers.

Easy-To-Use Dashboard: Manage all your automation from one simple or intuitive interface.

Secure and Reliable: your data and privacy are their top priorities.

>>> VISIT THE OFFICIAL WEBSITE <<<

Why you can buy this product

Save time on daily tasks

No need to manually follow, like, or comment — InstaBoost will do everything for you.

Increase visibility without effort

Stay active or visible on Instagram even when you are not online

Grow your social audience faster

automatically engage your followers or influencers and grow your following organically.

Build genuine connection

It will target the right user, resulting in more engagement and loyal followers.

Maximize your social influence

InstaBoost helps you interact strategically, enhancing your online presence and authority.

Hassle-free Social media management

In InstaBoost you get a simple dashboard that lets you set and forget it.

AI-generated Hashtag for better reach

It will automatically optimize your posts with Revent, Ai generated Hashtag to expand your reach.

Consistent presence, even when you are away

InstaBoos keeps your account active and engaging, even when you are doing something else.

Reduce the risk of burnout

Automation lets you maintain a hard presence without feeling overwhelmed by constant engagement demands.

Increase credibility and social proof

A growing follower count and higher engagement level signal to new visitors that your account is active and influential.

Drive more traffic in your profile

This tool engaging with targeted users brings more profile visits and clicks to your content.

Outperform competitors on social media

This tool helps you stay ahead of competitors by automating the repetitive tasks they may still be doing manually

Flexible and customizable automation

It gives you access to Set rules for how and when to engage, giving you full control over your automation strategy.

Improved time management

You can focus on creating content or other aspects of your business while this tool handles engagement.

Affordable, high-impact solution

You can achieve significant results regarding follower growth and audience interaction for a small investment.

Quick Setup and Easy to Use

To use this tool no complicated setup or tech skills are needed — start the automation and let it work for you.

>>> VISIT THE OFFICIAL WEBSITE <<<

InstaBoost #Instagram #growyourInstagramid #InstaBoostReview

NeoCast Review: Create Your Own TV Channel or Broadcast Without Any Hassle

Saif Al Shahriar — Mon, 10 Feb 2025 15:48:27 +0000

What is NeoCast

NeoCast is the world’s fastest AI app. It enables you to create your own TV channel without any hassle an. is always available to help you rebroadcast brands or products., generate millions of views for 100% free promotion, and earn passive income. NeoCast also helps you manage your TV channels, and users like its theitser-friendly dashboard.

NeoCast is specially designed for creators, entrepreneurs, influencers, and businesses that want to elevate their content to the next level. It provides the tools to build brand awareness and engage with your audience effectively and easily.

NeoCast review: features

AI broadcast app

Neocast is the fastest and easiest broadcasting app…..

No need for installation or configuring anything…just plug and play

DFY 24/7 Feed

With the NeoCast AI App, you don’t have to stream or create any content all is done for you

NeoCast Optin

Embed your optin from over your channel and start building the red-hot list

Build-in Views Generator

The most robust feature of NeoCast.

Turn it on and watch millions of views pour into your channel effortlessly

NeoCast AR Intergration

Seamlessly integrate with your favorite autoresponder with 1 click

NeoCast mobile Edition

NeoCast is allowed to also operate this, even from your mobile phone….

Whether it’s an Android,iPhone, or tablet, it will smoothly work

Training Videos

There is NOTHING missing in this training….

Everything you need to know is explained video or text in detail

World-class support

Do you have a question? Just reach out to them, and their team as soon as possible will do their best to fix your problem.

>>> VISIT THE OFFICIAL WEBSITE <<<

NeoCast review: How it works

NeoCast AI works in 4 easy steps:

Step 1

Access: click on the link to get instant access to NeoCast.

Step2

Broadcast: Instantly create a fully functional TV channel within only 30 seconds

Step3

Blast: turn on the built-in views-generator and start attracting millions of eyeballs

Step 4

Profit: gain all the necessary data to grow your businesses with a comprehensive reporting tool

NeoCast Review: Money Back Guarantee

And given everything the NeoCast AI APP does and for such a low price, this is a no-brainer.

But they don’t want to be held back by anything…

That’s why they giving you 30 days to test this all out and make sure it’s for you.

In case you change your mind for any reason, all you have to just inform them and as soon as possible they will issue you a refund.
>>> VISIT THE OFFICIAL WEBSITE <<<

Neocast #Neocastreview #ownTVchaneel #tv #brodcast

Print-On-Demand (POD) Marketing: The Ultimate Guide

Saif Al Shahriar — Sun, 19 Jan 2025 08:30:33 +0000

E-commerce has transformed how businesses function by introducing unique models such as POD (Print-On-Demand). It has become really popular because it is more flexible, requires less investment & can provide more profits. This article provides an in-depth exploration of POD marketing; how it works, the advantages and disadvantages, and effective strategies for success.

What does Print-On-Demand (POD) even mean?

Print-on-demand is a business model that allows products to be created and printed only after an order has been placed, thereby eliminating unnecessary inventory. There’s no inventory management required, as the items are produced on demand. These POD products include T-shirts, hoodies, mugs, phone cases, tote bags, posters, and much more. They are often sold online, through e-commerce websites, with a digital marketing approach reaching a larger audience.

How POD Works

There are several key steps in the POD process:

Design Creation: Designers or entrepreneurs design original artwork or graphics that is relevant to their target market.

Pick a POD platform In our case: where will you sell your designs? Teespring, Printful, Redbubble, and Merch by Amazon are popular POD platforms. They handle production, shipping, and, in some cases, customer service.

The uploaded designs are applied to various products. Sellers have the ability to create product listings with descriptions personalized to their liking, images, and prices that fit within the target audience of buyers.

Marketing: The traditional ways to bring customers to the store. This includes social media marketing, email campaigns, influencer partnerships, and paid advertisements.

They print the design onto the selected item and ship it to the customer immediately after a purchase has been made.

Profit Making: Sellers can earn a profit that is retail price minus production price minus platform fees.

Why POD Marketing is Popular

POD is attractive because it is simple and scalable. Here are a few of the reasons this model is working:

Low Startup Costs:

Unlike conventional retail, POD does not require buying products in bulk. Since entrepreneurs only pay for products after they make a sale, this dramatically lowers their financial risk.

Minimal Risk:

With no unsold stock to fret about, sellers can play around with designs and products without risking their finances too much.

Customization:

On-demand printing allows for limitless creativity. The sellers can target niche markets by providing designs and merchandise catering to specific interests, hobbies, or demographics.

Scalability:

As demand increases, sellers can scale product lines or launch new designs without the constraints of logistics.

Accessibility:

Anyone with an internet connection can launch a POD business with so many POD platforms out there. It is able to use design tools with ease and manage the store.

>>> LEARN MORE <<<

PODmarketing #printondimant #printondimandmarketing #whatispodmarketing

A Detailed Comparison of CPA Marketing vs Affiliate Marketing

Saif Al Shahriar — Sun, 12 Jan 2025 08:02:53 +0000

Below are some of the most frequent and searching questions online on CPA Marketing vs. Affiliate Marketing. The two have established themselves as mainstays for companies striving to broaden their online exposure and grow profits. But they are far different in terms of execution, objectives, and profit. In this article, we explore both types of marketing, and their key differences, and help marketers, advertisers, and entrepreneurs make an informed decision.
>>> LEARN MORE <<<

What is CPA Marketing?

CPA marketing, or Cost-per-action marketing, is a performance-based marketing model in which advertisers pay affiliates for specific actions or conversions that users take. These actions could include:

Signing up for a newsletter
Filling out a form
Downloading an app
Making a purchase
In CPA marketing, the affiliate is paid only when a specific action is taken. This means it is a low-risk strategy for advertisers where they only pay for results;

CPA Marketing vs Affiliate Marketing: CPA Marketing pros and cons

Advantages of CPA Marketing:

Advertiser returns are guaranteed by paying only for completed actions; and low-risk investments.

Higher Conversion Rate: More action-oriented which is usually easier to accomplish than making a sale.

Broad Range of Actions: Advertisers can target actions that cohere with their goals like downloading apps or generating leads

Scalability: Having clearly defined metrics, allows campaigns to be scaled based on their performance.

CPA marketing disadvantages

Setup Problems: What you need to measure and describe what to do.

High Competition: An attractive option for affiliates, resulting in competitive payouts.

Compliance Concerns: In the pursuit of driving actions, affiliates could potentially resort to dubious methods, putting the advertiser’s reputation on the line.

What is Affiliate Marketing?

Affiliate marketing is an umbrella term for this performance-based marketing strategy, in which an affiliate earns a commission based on sales or traffic sent to the advertiser’s website. Affiliates promote products or services through various channels, including, but not limited to, blogs, social media, and email marketing.

The Essentials of Affiliate Marketing:

Advertisers — businesses or individuals who provide goods or services.

Affiliates: They are also known as individuals or entities who promote the products/services.

Customers: They are the end users of the products/services.

Networks: Mediation between Advertisers and the Affiliates, where they provide tracking and payment.

Affiliate Marketing pros and cons

Benefits of Affiliate Marketing:

Reach: Affiliates utilize various platforms to promote a brand.

Flexibility: Affiliates can promote the products/services that are a good fit for their audience.

Low Initial Cost of Entry: Affiliates can get started for little money, by simply creating content.

Recurring income: Affiliates gain residual income from consistent commissions.

disadvantage of Affiliate Marketing:

Slow Payments: Affiliates may wait weeks or months to get their commissions.

Traffic Dependency: Traffic generation is the key to success.

Oversaturation: Popular niches can have a lot of competition.

Advantages: Fraud Risks — Advertisers are at risk with things like bogus sales, phantom traffic, etc.
>>> VISIT THE OFFICIAL WEBSITE <<<

cpamarketing #affiliatemarketing #cpamarketingvsaffiliatemarketing

ConvergeAI Review: create courses by using this app in 2025

Saif Al Shahriar — Mon, 06 Jan 2025 05:11:05 +0000

What is ConvergeAI?

ConvergeAI Review: It is an advanced artificial intelligence application designed to streamline the process of ideating, validating, and building a course, book, or how-to guide in record time. This all-in-one platform is specifically crafted for idea validation and course creation, leveraging the power of AI to deliver efficient and effective results.

Unlike other tools that ride the wave of AI trends, ConvergeAI focuses on empowering users to create high-demand, marketable courses with ease. By simply inputting a keyword, users can generate courses that are not only compelling but also proven to sell. This innovative app uses cutting-edge AI technology, including 2.0 AI, to analyze market trends and deliver valuable insights.

Whether you are an aspiring educator, author, or entrepreneur, ConvergeAI simplifies the content creation process, helping you turn your ideas into reality faster than ever before. With its advanced features, this app makes it easy to stay ahead in today’s competitive digital marketplace.

ConvergeAI Review: Features

The Only App That Uses The Shares “AI 2.0”
Hassle-Free Build Your Own AI Empire NOW
Create And Sell Your AI Courses In Any Niche Within MINUTES…
All the work is done for you, and there is no manual work needed.
Never worry about traffic, Converge sends us hundreds of customers a day…
Siphon Off The $31 Billion Market Using ConvergeAI
There Needed No Research, Code, Writing, Or Any Manual Work..
Never Pay Month After Month Again (Ticking Clock)
No Initial Payment Required, Start at No Cost
Beta-Tester Launched Their Courses And Together They Made $195,856.21.
1-On-1_Support_Personal Help Support On Any Problem You Might Face…
30 Days Money-Back Guarantee
>>> VISIT THE OFFICIAL WEBSITE <<<

What Does This Software Provide?

ConvergeAI is packed with powerful features designed to revolutionize the way you create, market, and sell courses or digital products. Here’s what this cutting-edge software brings to the table:

AI Course Manifest

Creating a course outline can be daunting, but ConvergeAI simplifies it for you. The software automatically generates a complete course structure, including what to teach and how to break down the subject—no manual effort required.

AI Sales Pages

Selling anything online requires an effective sales page. ConvergeAI doesn’t just give you a good sales page; it delivers an AMAZING one. These pages are custom-written by top-tier copywriters and designed by leading studios. They’re tested and proven to convert 10x better than competitors.

AI Email Sequence

With ConvergeAI, you’ll get a custom email sequence that keeps engaging your leads daily. This feature turns new customers into loyal, repeat buyers, effectively doubling or even tripling your revenue without extra effort.

AI Ads

Running ads has never been easier. ConvergeAI provides dozens of ready-to-use, custom-designed ads for platforms like Facebook, Google, YouTube, and TikTok. No editing or creating is needed—just upload and start driving traffic immediately.

Built-In Payment Gateway

Accept payments effortlessly via PayPal, Stripe, or direct credit card. ConvergeAI’s built-in payment gateway makes collecting money simple from day one.

AI Traffic

Generating traffic is no longer a hassle. ConvergeAI includes an advanced traffic generation feature that floods your pages with high-quality, 100% buyer traffic.

Autoresponder Integration

With a single click, you can integrate your favorite autoresponder to start collecting leads instantly. No coding knowledge is required—just connect your account, and ConvergeAI handles the rest.

From creating course outlines to driving traffic and managing payments, ConvergeAI does it all, empowering you to succeed effortlessly in the digital marketplace.
>>> LEARN MORE <<<

courses, #ConvergeAI,#ConvergeAIreview, #creatcouress, #converge ai,

TubeTargeter Review: Boost Your YouTube Ads Campaign Profit in 2025

Saif Al Shahriar — Sun, 29 Dec 2024 15:07:27 +0000

What is TubeTargeter?

TubeTargeter is an innovative but easy-to-use tool that helps YouTube advertisers get more out of their budgets. It brings smarter targeting and talks about better lead generation by accessing YouTube’s hidden algorithms. TubeTargeter has everything you need to create, optimize, and target video content — whether you’re an influencer or a brand.

TubeTargeter is unique because it integrates directly with influencer platforms. Advertisers can build a network of influencers using this to improve their reach and engagement. It also offers advanced targeting and optimization tools that help users maximize their advertising budget and reach their target audience.

Not only does TubeTargeter make YouTube advertising easier, but it also adds value to its partnership ecosystem by providing more advanced features for users on those platforms. This development leads to a win-win situation as advertisers receive better services and results, and platforms offer more powerful tools to their community.

TubeTargeter review: features

Exploit YouTube’s ‘BUYER ONLY’ Traffic section for high-converting Traffic.
Spy On Any Video or channel in any niche for an unfair advantage.
find out which offers, landing pages, and video ads are the best for any niche.
use other people.s PROVEN-To-Convert video in your ads
It is a newbie-friendly,cloud-based app that gets you traffic, leads, and sales right out of the gates.
Complimentary upgrade to a commercial license for another way to profit with TubeTargeter (when you get this now)
turn an investment of 45 or less into 3 figures in profit (rinse and repeat as often as you want)
find the best-converting campaigns so there is no guessing
no stress about showing your face on camera or creating videos (this is so much easier and in)
get access to 10 ‘done for you’ video ads campaigns for hot affiliate offers with guaranteed approval to promote (THIS IS GREAT if you don’t currently have something to promote)
Due to laser-tight targeting get hot buyer traffic flowing for pennies per click
Real-life case studies and step-by-step training included
>>> VISIT THE OFFICIAL WEBSITE <<<

Why you can buy this product?

Banishing YOU from YOUTUBE: slay the ‘BUYER ONLY’ Traffic Section of YouTube for converting traffic for any offer in any niche

Get started with a baby traffic spend of $5 (and learn how we ramp this into $100+)

And you get traffic moving quickly without a lot of hassle.

No experience whatsoever is needed of any kind because we provide everything you need to start making money from day #1

This app will give you an unfair advantage that gives you everything you need to get traffic, leads, and sales without having to spend a lot of money

At this moment, YouTube is providing the best traffic on the whole internet, and TubeTargeter makes fun of harnessing the best purchaser-targeted visitors that you can discover online

Now, there is no need to spend hours creating Videos or show yourself on Camera, just leverage the power of other people’s content

Get 10 hot affiliate offers all with guaranteed approval to promote each offer and get 10 ‘done for you’ video ads making this a foolproof way to get in the action and get paid with almost no work needed.

This is an instant recipe to success which actually great for new bees, intermediate marketers, and even experts

TubeTargeter is cloud-hosted, so you can get into the action and get results from anywhere

they also teach you with a strong real-life Case study, so you can do as the rest do too, and will get results way sooner

Also video training step-by-step

Not only that, you get over $1988 worth of bonuses that will help you make even more money with TubeTargeter

the monthly fee is being waived and the price is being slashed to make this so you can easily get your hands on it today

TubeTargeter Review: Whom It’s Suitable For?

>>> VISIT THE OFFICIAL WEBSITE <<<

TubeTargeter Review: Money-back guaranty

And given everything the TubeTargeter app does, and for so little, this is a no-brainer….

But they don’t want you to be held back by anything…

That’s why they are giving you a full 30 days to test this all out and make sure it’s for you.

In case you change your mind for any reason, all you have to do is inform them, and they will issue you a refund.

>>> VISIT THE OFFICIAL WEBSITE <<<

TubeTargeter Review: Frequently asked questions.

Q: Is TubeTargeter a subscription model?

A: The standard price for TubeTargeter is set at $97 per month, but during this special offer, when you get TubeTargeter, you’ll only need to make a small one-time investment for lifetime access.

Q: What is TubeTargeter and how does it work?

A: TubeTargeter scans and discovers trending monetized videos and channels using our unique algorithms in any niche, allowing users to create profitable video ads in seconds with zero work manually getting you in front of your perfect audience for rapid-fire results.

Q: Who needs TubeTargeter?

A: video marketers, affiliate marketers, product creators, email marketers, coaches, consultants, service providers, local business owners, or anyone who is searching for targeted traffic with little time or big investment needed.

Q: Is the TubeTargeter really newbie-friendly?

A: Absolutely, TubeTargeter is a great equalizer that makes it simple to get the most valuable buyer traffic to any offer in any niche.

TubeTargeter #TubeTargeterreview #youtubeAds #youtubeadsexpert #ads #makemoney #makemoneyonline

Christmas Bundle Review- Unlock Lifetime Access to 13 Exclusive AI Tools Today

Saif Al Shahriar — Wed, 11 Dec 2024 06:08:47 +0000

What is Christmas Bundle?

The Christmas Bundle is a completely new proposition that aims to give users lifetime access to 13 unique and powerful AI tools in such a way that they will not have to pay anything monthly for doing so. This limited-time offer enables those users to get access to the best of new technologies from different areas, and not get left behind in the digital world. Along with the Christmas Bundle, users will have the privilege to work with new platforms like Talk GPT, MailPal, Devio, GenAI, and AI Puzzle. In addition to that, it has some segments focused on such platforms as AI CB Profitz, PLR Plenty, GeminAI, MusicPal, SendValid, Verve, Mail Mate, and NFT Finder. This whole platform is a one-stop-shop with diverse functions right from content creation and email marketing to musical composition and the exploration of the NFT universe. The Christmas Bundle is one chance that you do not have to miss if you want to use AI without recurring costs.

>>> VISIT THE OFFICIAL WEBSITE <<<

About Christmas Bundle:

Here are the Apps that you are going to get with Christmas Bundle:

Mailpal

Drip Killer: The e-commerce autoresponder which is recognized by both Gmail and Yahoo, thus being the world’s first one, allows you to send Unlimited Emails to Unlimited Subscribers With Higher Inboxing Using DMARC, DKIM, And SPF integrated FREE SMTP!

DMARC, DKIM, and SPF tools are already in place for you along with the integrated autoresponder. You will see higher in-boxing & click rates.
Send Unlimited emails to as many subscribers as you want.
All-in-one e-commerce Autoresponder: Take advantage of creating popups, automating email communication, as well as targeting email marketing by syncing your store with Mailpal.
MailPal offers a drag-and-drop builder to automate both the daily to-dos and marketing workflows.
TalkGPT

Latest AI: The first app to use OpenAI’s new ChatGPT 4o technology turns your voice commands into remarkable pictures, videos, and websites, writing codes at the speed of light in a matter of seconds.

The World’s first True OpenAI’s ChatGPT 4.o™ powered AI app is blazing its new trail.
Instant, Voice-activated Answers Across All Formats, No Typing Needed.
VoiceOver: Text to Speech (TTS): Transform written words into lifelike voices with 500+ voices across many different languages and accents.
AI Image Generator: Using artificial intelligence image generators make breath-taking pictures.
Devio

1- Click “AppSumo Killer” The app allows you to start your own software-selling site/business in 30 seconds! + Along With Hundreds Of Done-For-You Software with Commercial Licenses!

AI software and its first acquaintance with the world of technology, offering full self-autonomy with ChatGPT 4.2’s help.
Enter the world of Done-For-You apps and software whose services facilitate the operation of the platform.
Ready-to-go platform immediately by adding pre-made apps; time is of the essence, no need to do all the work.
Another high-pitched tuning is to sell, for example, an unlimited number of apps with NeoDev, thus increasing your profit manyfold.
Integrate more than one payment method and you can earn through easy logistics moving and sale of goods.
GenAi

World’s 1st App Using Google’s Latest AI Tech Generative that Use your Text writing And Siri-Like Voice Commands– A new era!–As if Speaking your Heart Out!– Into high-quality marketing content in minutes!

World’s First App Fully Powered By Google’s Latest Generative AI Tech…
Craft An AI Avatar Character That Feels Lifelike As Well As A Video In Just About Any Niche…
Produce AI Images Ultra HD With A Single Keyword…
Change gray images to ultra-realistic 4K images…
Ai Puzzle Maker

Earth’s premier AI-powered cloud-based platform that provides the creation of unique puzzles, riddles & maze books, and over 1000 other puzzles with commercial licenses!

Is able to make puzzles, riddles & maze books that are very unique in minutes
Form hundreds of books full of puzzles for you in minutes
Keyword To Puzzle Book Creator Software
Thousands Of Pre-Made Puzzles, etc. With PLR License
Sell Unlimited Puzzles & Other Books On Amazon KDP
Ai CB Profitz

WILD / REVOLUTIONARY WORLD FIRST ChatGPT 4o Powered Tech BUILDS Fully Automated 100% D.F.Y Clickbank Affiliate Sites & Exponentially Fuels Unlimited Free Traffic IN 60 SECONDS OR LESS!

Create Unlimited Content Using ChatGPT Now…
Fresh Daily Reviews Already Created For Best Selling Clickbank Products!
Everything “Done-For-You” To Profit With No Work: Videos, Bonuses…
Money Websites That Generate PreloadedMoney
All content is written automatically without you typing any —.NONE.
Create Fresh, New Content For You To Post Daily That Converts
PLR Plenty

Groundbreaking Self-Updating PLR Builder Builds Unlimited PLR Sites with 400,000+ PLR Products in a List of 20+ Niches for A TIME All times Low Price!

Create and Sell Unlimited PLR Ebooks & Articles On Amazon Kindle Or Clients Directly With UNLIMITED COMMERCIAL + PLR LICENSE
BUILD YOUR OWN HIGHLY LUCRATIVE PLR EMPIRE!
All Done For You PLR Sites are Fully SEO Optimized
400000+ MULTIPLE NICHE PRODUCTS WITH UNLIMITED PLR LICENSE
Do So Without Any Efforts And Work From Anywhere In The World
PLR Builder Built Unlimited PLR Sites for passive income on Autopilot.
Gemin Ai
Introducing the World’s First True AI app Powered by Google New Gemini AI model Offering Text, Image, Audio, Video, and Code to Your Queries Instantly. This High-tech App Is Outdoing ChatGPT-4 And Creating Real-time Multimedia Reactions Quickly Within Second..!

First Ever Google’s Gemini™ Powered Ai Chatbot in the World
Digital Content Creation Revolution: Make digital content creation more efficient, compelling, and impactful.
So, let us transform your coding efforts: Making coding simple, effective, and usable for everyone.
AI with Enhanced Multimedia Interaction: Provides the best picture and video talking experience with the AI bot
Charge your clients and earn your first dollars!
MusicPal

First to Market Soundraw AI-powered App Creates Spotify and Apple Music Kind of Premium Platforms for Lifetime without Any Monthly Fees!

Get instant access to the AI-powered MusicPal App
Create your own music with a few clicks
Save By cancelling your Spotify subscription
Access your favorite tracks with unlimited skips
Save your favorite Unlimited Music/Tracks with one tap of a button, which is exactly what you can do!
One Million+ Ready-to-Use Tracks
SendValid

Revolutionary: Use the First to Market Hyper Ai Technology to Construct, Clean, and Optimize the Record with 99.9% Deliverability & Higher Open Rate For Lifetime Without Any Monthly Fees

The first email list cleaning app and optimizer for higher deliverability and open rates on the planet.
No necessity to question whether to list cleaning or email app is on the bill of your account for the monthly fee.
Send Valid comes with an AI email writer that can write high-converting emails for your campaigns.
100% Newbie-friendly and easy-to-use software.
The FULL Commercial License is inclusive — you may sell Lead generation services to your own clients
Verve

VERVE is a LinkedIn loophole worth $8 billion that gives us $500 per hour by working just 1–2 hours a day in this Done-For-You Business in a Box system!

Target businesses that are on Linkedin and are seeking employees to be involved in their continuing projects.
Freelancing is UNQUESTIONABLY the most viable business if you are looking to embark on the web because you provide services to people that they not only really want but also need
Earn hundreds daily by spending only 1 to 2 hours per day
Different kinds of income sources (freelancing and NFTs)
Doing business with zero stress because all the functions that can give you a headache will be taken care of for you
Mailmate
Master of the World’s Premier Autoresponder Compliant with Gmail and Yahoo’s update as of February 2024 to Send Unlimited Emails to Unlimited Subscribers with No Monthly Fee!

100% Done For You DMARC, DKIM, And SPF integrated autoresponder to get higher inboxing & clicks.
Send UNLIMITED Emails to Unlimited Subscribers.
Generate unlimited leads using Ai technology.
Build your list with a 1-click opt-in for users
Get 100% verified email addresses instantly
NFT Finder

NFT Finder is a software that helps you to discover moneymaking NFTs and with a single click, helps you generate thousands of dollars worth of sales.

No Restrictions No Limits You can create and download unlimited NTFS without any restrictions.
Immediately find undervalued NFTs that are set to SKYROCKET
Find unreleased NFTs, get in early, and earn more profits
Create & sell NFTs to your client with a commercial license in minutes
New Blockchain-based technology with an easy-to-use newbies-friendly interface
Verify the legitimacy of the NFTs easily

>>> VISIT THE OFFICIAL WEBSITE <<<

Christmas Bundle Review- Features

Crazy 99% OFF EVERYTHING — TODAY ONLY
$200,000 MADE WITH THIS Mystery SOFTWARES — YOU Seem BE NEXT!
HUNDREDS ARE As of now GETTING RICH — DON’T BE Cleared out BEHIND
10+ Robotized CASH MACHINES — LET THE Program WORK FOR YOU
30+ STEP-BY-STEP TUTORIALS
BRAND Unused FOR 2024: HIGH-DEMAND SOFTWARES TO MAXIMIZE YOUR INCOME!
GET Overflowed WITH BUYERS Immediately — NO EFFORT.
Members are Win $100+ on Day 1 on Autopilot
ACCESS The Mystery Millionaire
180-DAY GUARANTEE — ZERO Chance, Full Discount. No Questions Asked
FAIL-PROOF: GET COACH YOU Actually UNTIL YOU MAKE MONEY!
FREE Blessing: To begin with 100 BUYERS Moreover GET THE Occasion “2025 Moment Benefit Framework” WORTH $3,997 — YOURS 100% FREE. Nowadays As it were!

How Does The Christmas Bundle work

All It Takes to Get Started With Christmas Bundle in just 3 simple steps

Step 1: Login-in to the dashboard

Step 2: Choose your preferred Services you need

Step 3: Activate and make a profit from all 13 apps.

>>> VISIT THE OFFICIAL WEBSITE <<<

Whom It’s Suitable For?

Agency Owners

Marketing Agencies

Affiliate Marketers

Online Entrepreneurs

E-commerce Store Owners

Content Creators

Freelancers

Consultants

Dropshippers

Social Media Influencers

Digital Product Creators

Virtual Assistants

App Developers

Online Coaches and Trainers

Frequently Asked Questions

Q. Do I really get ALL 13 apps for the one low price?

A. YES you do! But do understand that the price goes up every hour, and when the timer reaches 00:00 the opportunity is over for good.

So go ahead — get yours now — you are totally covered by our 180-day money-back guarantee.

Q. I’ve never earned money online before. Is this a good place to start?

A. Absolutely. We’ve cherry-picked these apps specifically for their beginner-friendly features. You don’t require any tech skills or prior experience, you receive world-class step-by-step instructions … and you can achieve great results.

Q. Is there an additional cost or expense?

A. There is NO budget required for hosting, websites, or traffic — ALL from these apps.

You’ll likely want to first upgrade to a few advanced tools but that’s after you start makinga profit!

>>> VISIT THE OFFICIAL WEBSITE <<<

ChristmasBundle #ChristmasBundlereview #tools #paid tools #makemoney

StoryKids Christmas Review- Create a Magical Christmas for Kids with StoryKids DIY

Saif Al Shahriar — Sat, 16 Nov 2024 14:52:46 +0000

what is StoryKids Christmas?

“StoryKids Christmas” is a DIY PLR product featuring 100 captivating Christmas-themed stories designed for young readers, aimed at providing a magical experience while enhancing business profits. Catering to the expanding children’s digital entertainment market, projected to reach $23 billion by 2032, these animated and visually engaging stories are adaptable for platforms like YouTube and social media, with easy sharing options in both vertical and horizontal formats.

Surprisingly, they are the only companies that let you sell these stories and re-market them fully as yours in your consumers’ minds so that you can receive 100% of the profit. Stories can be edited in Canva, so you don’t have to be a great designer or anything. All you need is a Canva account, a few simple edits to the stories to make them yours, and then you can go ahead and sell the stories under your brand. It is a great move for everyone who is after the children’s film market or who wants to integrate it into his/her festive sales promotions.
>>> VISIT THE OFFICIAL WEBSITE <<<

StoryKids Christmas Features

100+ Christmas Stories in Animated Format: These are amazing holiday stories with illustrations that are fun and colorful and they come in vertical and horizontal formats. This brings children the opportunity to connect with all the major platforms including social media and websites.
100% Editable in Canva: Designed through Canva, the stories are completed for your full customization experience. This means that it is easy to rebrand, change the text or the images, and add your own personal touch as well, even without having any advanced design skills.
PLR Rights Included: So, you can tweak almost everything and produce as well as resale the same through Etsy — retaining 100% of the income. Thus, you can sell them to your clients on several sites or include them in your membership portals beyond that.
High-Quality Images and Animations: Each story comes with exciting animations, combined with top-notch images, to entertain and educate the kids with real-life dramatization of the stories. These, therefore, are the most appropriate for the current digital generation that children are addicted to the most.
Access Anywhere, Anytime: By default, no complicated software is needed for that. The stories can be edited and accessed at Canva, which simply means that you can work from anywhere and you only need an internet connection.
Educational and Fun: They are rich in imagination and interactive games that are sure to be the preferred family stories for Christmas and the New Year. Despite the fact that they impart important life values and serve as an excellent uprising for good habits like kindness, friendship, and gift donation, still they represent winter to the greatest extent.
30-Day Money-Back Guarantee: The product is the most attractive with a 30-day money-back guarantee in order to give you a sense of security getting involved.

Introducing to the vendor

Herb Ptho, a WarriorPlus digital product creator, is a provider of amazing PLR products. As an expert in unmatched and inventive PLR bundles, Herb Ptho is committed to delivering full-cycle solutions that enable entrepreneurs to set up successful money-making businesses within a short time.

>>> VISIT THE OFFICIAL WEBSITE <<<

Funnel Details

Front-End: **StoryKids Christmas — $14.95Encloses over 100 excellent Christmas Stories both in vertical and horizontal formats, PLR rights, and Bonuses.
Introducing over a hundred Christmas stories in both vertical and horizontal formats so that you have additional PLR rights, plus bonuses.
**OTO1: StoryKids Christmas PRO — $37.95 This Product Allows You to Expand the Library with 200+ Stories, and the PLR rights are Lightly Enhanced.
Beyond the 200+ additional stories, the library is extended and the PLR rights are more flexible.
OTO1 Downsell: StoryKids Christmas PRO — $ 27.95 The same plan and now the cost is lower (OTO1) is offered as a down-sell.
They are the same as OTO1, albeit at a lower price.
OTO2: KittenKids Audiobook — $ 27.95 Over 150 audiobooks and cover images are provided, which are perfect for creating audio products for children.
More than 150 audio plus cover images are included, which are great for developing kids’ audio products.
OTO2 Downsell: KittenKids Audiobook — $ 17.95 It offers more than 100 audiobooks and cover pictures.
It contains over 100 audiobooks and cover images.

Extra Bonuses

100+ Christmas coloring pages,
100+ Christmas Penguin coloring pages,
100+ Christmas Snowman coloring pages,
50+ prompt StoryKids Christmas,
150+ Christmas greeting card template,

What can this AI do for you?

Enhances Imagination and Creativity
The 50 kid-friendly Christmas tales in StoryKids Christmas take children to a fantasy world, that has Santa’s great deeds, cultural traditions, and fabulous people, thus igniting their imagination and powering them to think creatively.

Builds Stronger Family Bonds
The act of reading them together, on the other hand, culminates in the formation of substantial family time that in turn nurtures the relationships that have been impacted by the distance between the family members during the holiday season.

Teaches Important Life Lessons
Every narrative is penned with the aim of implanting a sense of virtues like kindness, friendliness, generosity, and caring into youths’ hearts to facilitate their emotional intelligence and character formation.

Encourages a Love for Reading
Bright and cheerful ideas are the ones, in combination with the intriguing plots make children read these stories, thus leading to discovering the joy of reading and arousing a lifelong habit of reading books and stories.

>>> VISIT THE OFFICIAL WEBSITE <<<

StoryKidsChristmas #StoryKidsChristmasreview

plr #Storybook #Private Label Righgts #makemoneyonline #Christmas