Protein folding was a 50-year problem. Scientists called it the "holy grail of biology" — the question of how a string of amino acids spontaneously folds into a precise 3D shape that determines its function. Then in 2020, DeepMind's AlphaFold solved it. Not approximately. Not theoretically. Solved it well enough that the organisers of CASP (the biennial protein structure prediction competition) declared the problem effectively finished.
Here is what happened, how the model actually works under the hood, and why it matters for the tools you build today.
The Problem That Took Five Decades
Proteins are chains of amino acids. There are 20 standard amino acids, and a typical protein chain runs anywhere from 50 to 2,000 residues long. The number of possible folded shapes is astronomical — Levinthal's paradox estimated 10^300 possible conformations for a 100-residue protein. Brute-force search is impossible. Random sampling would take longer than the age of the universe.
Yet proteins fold reliably in milliseconds inside your cells. Nature found a shortcut. Cracking that shortcut computationally was the goal.

The combinatorial explosion problem: a 100-residue protein has more possible folds than atoms in the visible universe.
Traditional approaches fell into three camps:
Physics-based simulation (molecular dynamics): Model every atom and bond force. Computationally crippling — simulating one microsecond of protein dynamics takes months on a supercomputer cluster.
Template-based modelling (homology modelling): If a similar protein's structure is already known, use it as a scaffold. Works when you have a close evolutionary relative. Fails for novel proteins.
Energy minimisation (ab initio): Try to find the lowest-energy conformation. Gets stuck in local minima. Rosetta, the best pre-AlphaFold approach, achieved ~60% accuracy on CASP benchmarks.
None of these scaled. None of them could handle the 200 million proteins in the UniProt database.
How AlphaFold Actually Works
AlphaFold is not just "throw a transformer at protein sequences." The architecture has three major components that work together in a pipeline:

AlphaFold's three-stage pipeline: sequence processing with MSA embedding, structure module with IPA attention, and recycling with iterative refinement.
Stage 1: Multiple Sequence Alignment (MSA) Embedding
The model does not work from a single protein sequence. It first searches genetic databases for evolutionarily related proteins and aligns them into an MSA. The intuition: co-evolving residues that always mutate together are likely physically close in the 3D structure.
AlphaFold processes this MSA through a series of axial attention layers (row-wise and column-wise attention over the alignment matrix). This produces a pair representation — an N×N matrix where each entry (i, j) encodes the predicted distance and orientation between residue i and residue j.
# Simplified MSA processing flow
# Input: MSA matrix (num_sequences × num_residues)
# Output: Pair representation (num_residues × num_residues × channels)
msa_embedding = embed_sequences(msa_matrix) # encode amino acids + positional info
row_attn = axial_attention(msa_embedding, dim=0) # attend across sequences
col_attn = axial_attention(row_attn, dim=1) # attend across positions
pair_repr = outer_product_mean(col_attn) # (N, N, C) pair matrix
Stage 2: The Structure Module
This is where the magic happens. The structure module takes the pair representation and iteratively updates a set of 3D coordinates — one per residue — using Invariant Point Attention (IPA).
IPA is a form of attention that is invariant to global rotation and translation. Standard attention would lose the 3D geometry. IPA embeds each residue's local coordinate frame (its 3D position and orientation) into the attention computation so that the model reasons about relative positions rather than absolute ones.
At each iteration, IPA updates the residue positions based on predicted pairwise distances and angles from the pair representation. The module runs for 8 iterations (8 "recycling" steps), with each iteration refining the previous prediction.
Iteration 1: rough backbone trace, ~20 Å RMSD from ground truth
Iteration 3: secondary structure elements (alpha helices, beta sheets) resolve
Iteration 6: side-chain orientations begin to lock in
Iteration 8: final refined structure, often <1 Å RMSD
Stage 3: Recycling
The output from the structure module is fed back into the MSA embedding as additional features for the next pass. This recycling loop runs 3 times (not to be confused with the 8 IPA iterations within each pass). Each recycle improves accuracy by about 5-10% on CASP metrics.
The key insight: protein folding is iterative in nature too. AlphaFold mimics the physical process — coarse structure forms first, then local details refine — but does it in a learned latent space rather than atomic simulation.
Code: Running AlphaFold Locally
You do not need a DeepMind cluster. The open-source implementation runs on a single GPU. Here is the practical setup:
# Install via ColabFold (MMseqs2 + AlphaFold wrapper)
# pip install colabfold colabfold[alphafold]
from colabfold.batch import run_alphafold
# Single sequence prediction
sequence = "MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP"
run_alphafold(
queries=[("p53_dna_binding", sequence)],
result_dir="./predictions",
num_models=1,
num_recycles=3,
model_type="auto", # auto-selects best model for sequence length
use_gpu_relax=True # AMBER energy minimisation for final refinement
)
Benchmarks on consumer hardware:
| Hardware | ~100 residue protein | ~500 residue protein | ~1000 residue protein |
|---|---|---|---|
| A100 80GB | 2 minutes | 8 minutes | 22 minutes |
| RTX 4090 24GB | 4 minutes | 15 minutes | 45 minutes |
| RTX 3080 10GB | 8 minutes | 35 minutes | OOM (use CPU fallback) |
| Apple M2 Max | 12 minutes | 50 minutes | ~2 hours |
The 10GB limit matters: AlphaFold's memory usage scales roughly as O(N²) with sequence length due to the pair representation matrix. Proteins above ~800 residues on 10GB GPUs require gradient checkpointing or CPU offloading.
Three Things AlphaFold Changed Overnight

The timeline of structural biology before and after AlphaFold: experimental structures (blue) vs predicted structures (orange). The inflection point is late 2020.
1. Drug Discovery Timeline Compression
Traditional structure-based drug design required an experimentally solved protein structure (X-ray crystallography or cryo-EM) — 6 to 18 months per target. AlphaFold predictions now serve as starting structures in under an hour.
In 2023, Insilico Medicine used AlphaFold-predicted structures to discover a novel CDK20 inhibitor in 12 months from target identification to preclinical candidate — a process that historically took 3-5 years.
2. The Protein Universe Doubled
In July 2022, DeepMind and EMBL-EBI released predicted structures for all 214 million proteins in the UniProt database. Before this, about 190,000 protein structures had been experimentally solved over 50 years of structural biology — roughly 0.1% of known proteins.
Overnight, structural coverage went from 0.1% to nearly 100%.
3. Metagenomics Became Actionable
Environmental DNA sequencing produces millions of novel protein sequences with no known relatives. Before AlphaFold, these were annotation dead ends. Now you can fold them. New enzymes for plastic degradation, carbon capture, and industrial catalysis are being discovered by folding metagenomic sequences and screening predicted active sites.
What AlphaFold 3 Adds (June 2026)
The third generation, released by Google DeepMind and Isomorphic Labs, extends the framework beyond single-chain proteins:
- Protein complexes: Predict how multiple proteins dock together. The model handles up to 5,000 residues across all chains combined.
- Protein-ligand interactions: Small molecule binding sites and affinities. This is the key feature for drug discovery — you can now screen virtual compound libraries against predicted binding pockets.
- Post-translational modifications: Phosphorylation, glycosylation, and other modifications that change protein behaviour.
- Nucleic acid interactions: DNA and RNA binding predictions. AlphaFold 3 models protein-nucleic acid complexes with accuracy approaching experimental methods.
The diffusion-based architecture replaces the structure module IPA with a more general diffusion process that handles arbitrary biomolecular systems:
# AlphaFold 3 uses a diffusion model for structure generation
# Unlike AlphaFold 2's iterative IPA which updates coordinates directly,
# AF3 diffuses from random noise to the final structure
def diffusion_step(noisy_coords, pair_repr, timestep):
# Denoise coordinates conditioned on pair representation
denoised = denoiser(noisy_coords, pair_repr, timestep)
return denoised
# Run 200 diffusion steps from t=1 (pure noise) to t=0 (final structure)
coords = torch.randn(num_atoms, 3) # start from random positions
for t in reversed(range(200)):
coords = diffusion_step(coords, pair_representation, t / 200)
The catch: AlphaFold 3 is not fully open source. The code and model weights are released for non-commercial use through the AlphaFold Server, but the training pipeline and commercial licensing require Isomorphic Labs partnership. This is a meaningful shift from AlphaFold 2's fully open Apache 2.0 release.
Practical Takeaways for Developers
You do not need a biochemistry PhD to use this. The tooling is mature enough that a developer familiar with Python can fold proteins competitively with structural biologists from five years ago. Here is where to start:
- ColabFold (colabfold.py): The easiest entry point. Wraps AlphaFold 2 with MMseqs2 for MSA generation. Runs in Google Colab on free T4 GPUs for proteins under 400 residues.
- ESMFold (Meta's contribution): A language-model approach that predicts structure directly from sequence without MSA. 60x faster than AlphaFold but ~10% less accurate. Useful for high-throughput screening.
- AlphaFold Database (alphafold.ebi.ac.uk): 214 million pre-computed structures. Check here first — your protein of interest is probably already folded.
- Chai-1 (Chai Discovery): A newer open model that matches AlphaFold 3 on many benchmarks with fully open weights. Worth watching if the AF3 licensing concerns you.
The protein folding problem is solved. The next frontier is using those structures faster and more creatively than the competition. The tooling is ready. The database is built. The only question is what you build with it.
What protein or biological problem are you working on that could benefit from structural prediction? Drop a comment — I read every one.
Top comments (0)